100 Best Helsinki Blogs and Websites (UU)

Follow Top 100 Helsinki Blogs from one place on Feedspot Reader
The best Helsinki blogs from thousands of blogs on the web and ranked by relevancy, authority, social media followers & freshness.
Helsinki is the capital city of Finland.

Helsinki Blogs

Here are 100 Best Helsinki Blogs you should follow in 2024

1. News from Finland - 'Helsinki Times'

News from Finland - 'Helsinki Times' Helsinki Times is an independent online newspaper covering news and events in Finland.
helsinkitimes.fi
Facebook Followers 29.9KTwitter Followers 27.2K Frequency 8 posts / day Domain Authority 64 Get Email Contact Get Influential Bloggers ContactsGet access to 250k active Bloggers in 1500 niche categories.Get targeted media contact list in your niche at your fingertips so you can focus on running your campaign.Email us the type of bloggers you want to reach out for your marketing campaign at anuj@feedspot.com Copy email. We'll share blogger's data in an Excel or CSV format.

2. My Ginger Garlic Kitchen

My Ginger Garlic Kitchen My name is Anupama Paliwal, and I welcome you to My Ginger Garlic Kitchen, an Indian Fusion Food Blog, where I share my recipes, food styling tips, and how to's. Here, you will discover exemplary video tutorials and recipes of Indian and western food with spices and herbs.
mygingergarlickitchen.com
Facebook Followers 163.1KTwitter Followers 704Instagram Followers 7K Frequency 5 posts / week Domain Authority 42 Get Email Contact

3. Insights for Technology Driven Visionary Leaders | Management Events

Insights for Technology Driven Visionary Leaders | Management Events Management Events is an innovative growth organization with plenty of inspiring career opportunities. anagement Events brings global visionary leaders together & provides fresh business insights & trends.
managementevents.com
Facebook Followers 12.7KTwitter Followers 2K Frequency 1 post / quarter Domain Authority 41 Get Email Contact

4. Music Video Hype

Music Video Hype Music Video Hype is your leading Europe music platform for Music Video Promotion that gives all artists the opportunity to be recognized in Europe and other parts of the world. We guarantee real and organic view every day for life.
musicvideohype.com
Facebook Followers 37.1KTwitter Followers 4.8KInstagram Followers 4K Frequency 15 posts / quarter Domain Authority 64 Get Email Contact

5. Metso Outotec Blog » Mining and metals refining

Metso Outotec Blog » Mining and metals refining broaden your knowledge of efficient mining processes and metals refining with this blog. Metso Outotec is a frontrunner in sustainable technologies, end-to-end solutions and services for the aggregates, minerals processing and metals refining industries globally.
mogroup.com
Facebook Followers 46.3KTwitter Followers 14K Frequency 1 post / week Domain Authority 58 Get Email Contact

6. Deconstructor of Fun Blog

Deconstructor of Fun Blog Deconstructor of Fun is a blog, a podcast, and an advisory company specializing in free-to-play games. The blog breaks both the gaming market and the best free-to-play games down to the details allowed. What makes Deconstructor of Fun stand out is that all content is coming from people who work directly in the games industry. There are now reporters, vendors, or marketers.
deconstructoroffun.com
Facebook Followers 2.2KTwitter Followers 3.1K Frequency 1 post / week Domain Authority 46 Get Email Contact

7. The Marketing Analytics Show

The Marketing Analytics Show The Marketing Analytics Show is all about helping you get better at marketing analytics. On this podcast, Anna Shutko will catch up with marketers and analysts to learn how they're using data to make better marketing decisions. Tune in for all the how-tos & actionable advice you can steal. This podcast is brought to you by Supermetrics.
supermetrics.com
Facebook Followers 126.9KTwitter Followers 8.4K Frequency 4 posts / quarter Domain Authority 53 Get Email Contact

8. Joy of Being

Joy of Being I am a wisdom keeper, co-creative guide/healer and sacred feminine leader. I want to fill your ears with self-love and inspiration.
soundcloud.com
Twitter Followers 155 Frequency 1 post / week Since Jan 2018 Domain Authority 94 Get Email Contact

9. Jussi Roine

Jussi Roine I write about things that interest me, mostly about Microsoft, cloud technologies, productivity and being outside my comfort zone. I'm a Microsoft Regional Director and Most Valuable Professional, and I work with Microsoft technologies.
jussiroine.com
Twitter Followers 5.6K Frequency 2 posts / week Domain Authority 23 Get Email Contact

10. A Seasoned Tester's Crystal Ball

A Seasoned Tester's Crystal Ball This blog is about thinking of things past, present, and future in testing. Author Maaret Pyhajarvi shares her ideas and experiences on software testing, software development, conference speaking, and organizing.
visible-quality.blogspot.com
Facebook Followers 130Twitter Followers 9.4K Frequency 1 post / week Domain Authority 38 Get Email Contact

11. RELEX Solutions

RELEX Solutions RELEX Solutions provides an integrated retail and supply chain planning system that delivers impressive results for customers around the world.
relexsolutions.com
Facebook Followers 1.3KTwitter Followers 1.6K Frequency 2 posts / week Domain Authority 44 Get Email Contact

12. Claned

Claned Explore our educational blog and industry insight in the educational industry.
claned.com
Facebook Followers 4.5KTwitter Followers 2KInstagram Followers 552 Frequency 3 posts / month Domain Authority 34 Get Email Contact

13. Tuonela Magazine » Blog

Tuonela Magazine » Blog Tuonela Magazine is a music magazine based in Helsinki focusing on metal, rock, indi, and alternative music. Stay tuned for photos, interviews, live reports, and news articles! Offering you all the hottest news as well as live reports, album reviews, galleries and interviews.
tuonelamagazine.com
Facebook Followers 5KTwitter Followers 719Instagram Followers 2.2K Frequency 1 post / week Domain Authority 31 Get Email Contact

14. Time to Shine Podcast : Public speaking | Communication skills | Storytelling

Time to Shine Podcast : Public speaking | Communication skills | Storytelling 'Time to Shine' presents interviews with successful public speakers who share their experience and secrets with you. Become confident and ready to shine in any speaking situation. It's time to shine in public speaking. 'Time to Shine' is hosted by Oscar Santolalla.
timetoshinepodcast.com
Facebook Followers 1.1KTwitter Followers 642 Frequency 2 posts / quarter Since Oct 2014 Domain Authority 30 Get Email Contact

15. Cesim Blog

Cesim Blog Business simulations blog about experiential learning in higher education & corporate training programs. Cesim is the world's leading provider of multilingual, multidisciplinary online business simulation games for higher education institutions and corporations.
cesim.com/blog
Facebook Followers 1.5KTwitter Followers 668Instagram Followers 360 Frequency 1 post / quarter Domain Authority 37 Get Email Contact

16. The Modern Employer Brand Blog

The Modern Employer Brand Blog Build awareness, learn about the method and become inspired in modern employer branding and talent marketing with Susanna Rantanen.
modernemployerbrand.com
Facebook Followers 67Twitter Followers 5.6KInstagram Followers 711 Frequency 6 posts / month Domain Authority 9 Get Email Contact

17. Jennifer Sandström

Jennifer Sandström A personal blog about travel, business & marketing, as well as stories, writing, books, photos & things related to everyday life in Helsinki & traveling.
jennifersandstrom.se
Facebook Followers 820Twitter Followers 787Instagram Followers 2.9K Frequency 2 posts / month Domain Authority 31 Get Email Contact

18. The Social Hotelier

The Social Hotelier A podcast that inspires hoteliers to create meaningful and memorable experiences for their customers, in pursuit of their passion. I, Sam-Erik Ruttmann share my views and experiences relating to hospitality, tech trends, and also relating to humanity. I am sitting down with world-class speakers, leading industry suppliers, top-performing hoteliers, sharing their inspiration, lessons they learned, and how to make an impact.
the-social-hotelier-show.blubrry.net
Facebook Followers 454Twitter Followers 646Instagram Followers 283 Frequency 1 post / week Since Jul 2017 Domain Authority 54

19. Development of Russian Law blog

Development of Russian Law blog Features Articles on Russian Law. Development of Russian Law (DRL) is an ongoing project looking at Russian Law and legal culture from a variety of interdisciplinary perspectives.
blogs.helsinki.fi
Twitter Followers 67 Frequency 4 posts / year Domain Authority 84 Get Email Contact

20. Happeo » Internal Communications

Happeo » Internal Communications Our Happeo blog is your number one source of news and ideas for Internal Communications teams, and anyone interested in the future of business communications and productivity. Happeo is a social intranet software that combines intranet, enterprise social networking, collaboration, and targeted distribution of news into a community-powered employee communications platform.
happeo.com
Facebook Followers 528Twitter Followers 2K Frequency 6 posts / year Domain Authority 37 Get Email Contact

21. Valoya LED Grow Lights

Valoya LED Grow Lights Valoya is a provider of energy efficient LED grow lights. Our LED lights have been developed based on an extensive plant photobiology research.
valoya.com
Facebook Followers 822Twitter Followers 982Instagram Followers 1.1K Frequency 1 post / month Domain Authority 37 Get Email Contact

22. Leadfeeder Blog

Leadfeeder Blog Articles on B2B marketing, sales and lead generation for those who want to sell more. Leadfeeder is a website visitor analytics software that shows you the companies visiting your website, how they got there, and what pages they clicked.
leadfeeder.com
Facebook Followers 5.4K Frequency 2 posts / week Domain Authority 50 Get Email Contact

23. Digital Workforce

Digital Workforce Digital Workforce is the leading service provider specializing in intelligent automation, RPA, and AI services on an industrial scale. Follow our blog that focuses on the latest news, trends, and tips and accelerate your career or your company's growth with RPA!
digitalworkforce.com
Facebook Followers 556Twitter Followers 841Instagram Followers 360 Frequency 1 post / week Since Apr 2016 Domain Authority 35 Get Email Contact

24. NYYITI Blog

NYYITI Blog Our blog addresses topical issues related to student wellbeing and takes a stand. Nyyti ry promotes the mental health and learning ability of students. We provide students and learning communities with information, support, and activities for mental wellbeing and coping.
nyyti.fi
Facebook Followers 6KTwitter Followers 3KInstagram Followers 7.4K Frequency 3 posts / quarter Domain Authority 39 Get Email Contact

25. The IT Experience Podcast - HappyToday

The IT Experience Podcast - HappyToday Podcast for those who want to improve Employee Experience of IT Services in large enterprises. We talk about IT Experience, how does it change the culture of IT Departments from SLAs to Experience Metrics and XLAs. If you use ServiceNow or other enterprise service management system to provide services to end-users, then this is for you.
happysignals.com
Facebook Followers 128Twitter Followers 503Instagram Followers 178 Frequency 1 post / week Since Apr 2019 Domain Authority 26 Get Email Contact

26. Nyyti ry Blog

Nyyti ry Blog Our blog addresses topical issues related to student wellbeing and takes a stand. The writers consists of the employees of Nyyti ry, other actors in the field of mental health as well as students. Catch up with all the latest blogs and articles about the Youth mental health. Nyyti ry promotes the mental health and learning ability of students. We provide students and learning communities with information, support and activities for mental wellbeing and coping.
nyyti.fi
Facebook Followers 6KTwitter Followers 3KInstagram Followers 7.4K Frequency 3 posts / quarter Domain Authority 39 Get Email Contact

27. Miradore | Device Management Blog

Miradore | Device Management Blog Helping you know the essentials on mobile device management, enterprise mobility management, and unified endpoint management.
miradore.com
Facebook Followers 10.5KTwitter Followers 943 Frequency 3 posts / quarter Since Nov 2018 Domain Authority 43 Get Email Contact

28. Paperiaarre | Handmade Books and Other Treasures

Paperiaarre | Handmade Books and Other Treasures Blogger Kaija Rantakari showcases handmade books, different bookbinding techniques, mixed media art taking many shapes, as well as her love for all things old and beautiful. She hopes to inspire her fellow paper enthusiasts through her paper explorations.
paperiaarre.com
Instagram Followers 7.3K Frequency 2 posts / quarter Since Sep 2007 Domain Authority 27 Get Email Contact

29. Julian Dontcheff's Database Blog

Julian Dontcheff's Database Blog The good DBA is one who learns from his mistakes, the best DBA is one who learns from other DBA's mistakes.
juliandontcheff.wordpress.com
Twitter Followers 2K Frequency 1 post / quarter Domain Authority 24 Get Email Contact

30. Inter:views | Cracking The Entrepreneurship Code

Inter:views | Cracking The Entrepreneurship Code Welcome to Inter: views. My name is Laurent Notin, I am on a quest to crack the entrepreneurship code. I created this podcast to give a voice to passionate small and medium entrepreneurs around the world. I hope that the stories, practical tips, and advice my guests share will inspire you to navigate your entrepreneurship journey better.
laurentnotin.com
Twitter Followers 129Instagram Followers 382 Frequency 1 post / week Since Jan 2020 Domain Authority 11 Get Email Contact

31. Fintech Daydreaming

Fintech Daydreaming A refreshing podcast by Paul Krogdahl and Ville Sointu looking at the world of Fintech and Banking Technology. Paul Krogdahl & Ville Sointu pick one topic in every episode and try to look at it through the lens of fintech disruption - or lack thereof.
fintechdaydreaming.com
Twitter Followers 312Instagram Followers 293 Frequency 1 post / week Domain Authority 11 Get Email Contact

32. Futudent - Video Dentistry Blog

Futudent - Video Dentistry Blog Read the latest news on modern ways of dental communication. See how video dentistry improves your communication with your patients, technicians and hygienists. Enter the future of dental service today!
futudent.com
Facebook Followers 4.5KTwitter Followers 335 Frequency 5 posts / week Domain Authority 26 Get Email Contact

33. Women in Tech Finland

Women in Tech Finland Get inspiring stories, intriguing role models and the latest statistics on women in tech finland. WITF aims to encourage and support women, and promote the values of diversity, equity and inclusion in technology. The network was born as an idea in fall 2012 by Marjo Miettinen and Anne Stenros.
womenintech.fi
Facebook Followers 9.5KTwitter Followers 846Instagram Followers 5.2K Frequency 5 posts / quarter Since Mar 2021 Domain Authority 33 Get Email Contact

34. The Arbitration Institute of the Finland Chamber of Commerce

The Arbitration Institute of the Finland Chamber of Commerce FAI administers domestic and international arbitrations governed by its Arbitration Rules and Expedited Arbitration Rules. Further, it appoints arbitrators in ad hoc cases when the arbitration agreement so provides, and acts as appointing auhtority under the UNCITRAL Arbitration Rules. FAI also administers domestic and international mediations governed by its Mediation Rules.
arbitration.fi
Twitter Followers 402 Frequency 2 posts / month Domain Authority 33 Get Email Contact

35. Arilyn

Arilyn We strive to make augmented reality a tool you can use every day. Make your communication more engaging, your brand more differentiated and create stories your customers remember.
blog.arilyn.com
Facebook Followers 2.3KTwitter Followers 782 Frequency 8 posts / year Domain Authority 33 Get Email Contact

36. And Read All over » linguistics

And Read All over » linguistics A blog about language and stuff by Joe McVeigh. Follow to keep up with latest from this blog
andreadallover.com
Twitter Followers 1.2K Frequency 3 posts / year Since Sep 2010 Domain Authority 19 Get Email Contact

37. SalesforceWay

SalesforceWay SalesForceWay Podcast is a podcast that is hosted by Xi Xiao. A weekly Salesforce podcast that helps you become a better Salesforce technologist. Listen to the podcast for obtaining quality information about Salesforce that help you become a better Salesforce developer.
salesforceway.com
Facebook Followers 5Twitter Followers 761 Frequency 2 posts / quarter Since Feb 2018 Domain Authority 28 Get Email Contact

38. VisiLean » Blog

VisiLean » Blog Look at our blog to find out what new projects we are currently working on along with our expert articles on lean construction. The Only solution that integrates Lean Methodology with BIM and Project Planning to guarantee savings on your overall projects costs.
visilean.com
Facebook Followers 114Twitter Followers 226Instagram Followers 485 Frequency 2 posts / month Domain Authority 24 Get Email Contact

39. hyper[in]

hyper[in] Hyper[in] is a real estate tech blog that helps professionals stay at the cutting edge of trends. We bring a game-changing solution for people who manage shopping malls.
blog.hyperin.com
Facebook Followers 110Twitter Followers 193 Frequency 6 posts / year Domain Authority 35 Get Email Contact

40. Sql Governor Blog

Sql Governor Blog SQL Governor helps companies to modernize their Microsoft data platforms and ease migration to the cloud. It offers an unbeatable, fact-based solution for managing and forecasting the SQL Server platform's capacity and performance. Follow our SQL Server blog to get the latest news and expert insights around SQL Server performance monitoring, capacity planning, optimization, and migration projects.
sqlgovernor.com
Facebook Followers 50Twitter Followers 165 Frequency 2 posts / quarter Domain Authority 23 Get Email Contact

41. Steve Kemp's Blog

Steve Kemp's Blog This blog contains the writings of Steve Kemp, primarily focussing upon topics relating to Debian GNU/Linux, free software & software development. Steve Kemp is a sysadmin located in Helsinki, Finland who is experienced in using and developing under GNU/Linux.
blog.steve.fi
Frequency 5 posts / year Domain Authority 42 Get Email Contact

42. Sisua Digital Blog

Sisua Digital Blog Insights gathers our news, blog and other material related to intelligent automation and RPA, articles related to digitisation, robotics and AI. The purpose of Sisua Digital is to find the best automation solutions for our customers that will help them on their digital transformation journey.
sisuadigital.com
Twitter Followers 82 Frequency 1 post / week Domain Authority 20 Get Email Contact

43. Vaimomatskuu Blog » Recipes

Vaimomatskuu Blog » Recipes Hi! My name is Jella and I'm a Finnish food blogger, content creator, and food photographer from Helsinki. Vaimomatskuu food blog always comes up with something delicious. And to have fun while cooking it! I hope you enjoy the results as much as I do. My typical recipe includes an eclectic mix of seasonal and local ingredients, lots of veggies, and a creative combination of flavors.
vaimomatskuu.com
Facebook Followers 1.2KInstagram Followers 18.4K Frequency 2 posts / month Domain Authority 29 Get Email Contact

44. A Composer's Diary

A Composer's Diary A blog about music, art and a composer's everyday life.
ceciliadamstrom.blogspot.com
Facebook Followers 1.1KTwitter Followers 293Instagram Followers 2.4K Frequency 3 posts / year Since Feb 2014 Domain Authority 8 Get Email Contact

45. Nosto Blog

Nosto Blog Learn how to increase your eCommerce revenue, conversions, and traffic. Read Company news, culture spots, and commerce experience trends, tips, and know-how from industry experts. With the help of powerful machine learning and a team of eCommerce experts around the world, we use shopper behavioral data to create digital commerce experiences that create customers for life.
nosto.com
Facebook Followers 5.6KTwitter Followers 2.6K Frequency 1 post / month Domain Authority 49 Get Email Contact

46. Angry Birds - Rovio Mobile

Angry Birds - Rovio Mobile Welcome to the Angry Birds official YouTube channel home of the world's angriest flock of furious feathered fowl.
youtube.com
Facebook Followers 24MTwitter Followers 607.6K Frequency 5 posts / week Since Jun 2006 Get Email Contact

47. Salibandyfi

Salibandyfi The official YouTube channel of the Finnish Floorball Federation. Salibandy is Finland's fastest growing and evolving team sports. We want to create a movement that generates experiences, well-being and success. There are about 400,000 enthusiasts in Finland with a floorball and a sled. There are already over 65,000 registered players and enthusiasts.
youtube.com
Facebook Followers 55.4KTwitter Followers 9.4K Frequency 1 post / day Since Mar 2011 Get Email Contact

48. Kiasma Museum

Kiasma Museum Located in the heart of Helsinki, Museum of Contemporary Art Kiasma offers you an easy access to the most interesting and invigorating art of our time. Kiasma is an open forum for the exchange of opinions and a continuous redefinition of art and culture.
youtube.com
Facebook Followers 37.8KTwitter Followers 13.8K Frequency 1 post / month Since Jun 2009 Get Email Contact

49. AppFollow

AppFollow AppFollow offers tools and resources to help you grow your mobile apps and games. If you are new to app business or a pro, these educational videos and webinar recordings are for every level.
youtube.com
Facebook Followers 1.5KTwitter Followers 2.8KInstagram Followers 330 Frequency 6 posts / year Since Feb 2015 Get Email Contact

50. SalesforceWay

SalesforceWay Become a better Salesforce developer with YOU together.
youtube.com
Facebook Followers 5Twitter Followers 761 Frequency 1 post / month Since Nov 2017 Get Email Contact

51. ErikKaum

ErikKaum ML Engineer making videos.
youtube.com
Frequency 1 post / quarter Since Aug 2011 Get Email Contact

52. Iltalehti » MUSIIKKI

Iltalehti » MUSIIKKI Iltalehti is a Finnish daily newspaper that covers various news topics, including music. The MUSIIKKI (music) section of the website features news, reviews, and interviews with Finnish and international musicians.
iltalehti.fi
Facebook Followers 417.1KTwitter Followers 151.8KInstagram Followers 114.2K Frequency 9 posts / week Domain Authority 78 Get Email Contact

53. Daily Finland

Daily Finland Daily Finland, an English online daily published from Finland.
dailyfinland.fi
Facebook Followers 21.2KTwitter Followers 2.7K Frequency 10 posts / day Domain Authority 37 Get Email Contact

54. Kesko

Kesko Kesko is a Finnish trade-related industry. In Kesko and K-stores, responsibility is everywhere to help us make good choices.
kesko.fi
Facebook Followers 20.6KTwitter Followers 10.7KInstagram Followers 14.9K Frequency 1 post / week Domain Authority 53 Get Email Contact

55. Cargotec podcasts

Cargotec podcasts Cargotec is a leading provider of cargo and load handling solutions with the goal of becoming the leader in intelligent cargo handling. Our solutions and services make global trade smarter, better and more sustainable. As leading players in ports, on roads and at sea, our business areas Kalmar, Hiab and MacGregor can optimise global cargo flows and create sustainable customer value. We want to lead the industry transformation and turn cargo and load handling into an intelligent and sustainable business.
soundcloud.com
Facebook Followers 3.8KTwitter Followers 5.2KInstagram Followers 1.1K Frequency 1 post / quarter Domain Authority 94 Get Email Contact

56. Music Finland

Music Finland Music Finland is an organization that promotes Finnish music internationally. The organization supports Finnish musicians and music industry professionals and provides information about music events and festivals in Finland. The blog features news, interviews, and updates about the Finnish music industry and its various genres.
musicfinland.com
Facebook Followers 8.5KTwitter Followers 6KInstagram Followers 5.3K Frequency 1 post / week Domain Authority 43 Get Email Contact

57. Building a Modern Employer Brand

Building a Modern Employer Brand Building a Modern Employer Brand -podcast is a weekly podcast bringing you a modern breath of air into HR marketing and employer branding. This podcast is dedicated to all modern growth companies and modern employer branding practitioners who want to do a job that influences talent audiences and adds value to growing and scaling modern businesses.
soundcloud.com
Facebook Followers 41Twitter Followers 1.3KInstagram Followers 850 Frequency 1 post / week Since Jan 2020 Domain Authority 94 Get Email Contact

58. MariaDB Foundation Blog

MariaDB Foundation Blog Latest MariaDB announcements, releases, developments, conferences, events, stories, and everything going on in the MariaDB community. The MariaDB Foundation is established to promote the development of the MariaDB Server. It supports continuity and open collaboration in the MariaDB ecosystem.
mariadb.org/blog
Facebook Followers 924Twitter Followers 2.8KInstagram Followers 1.2K Frequency 2 posts / month Domain Authority 84 Get Email Contact

59. Metso Blog » Mining

Metso Blog » Mining Broaden your knowledge of efficient mining processes and metals refining with this Blog. Metso brings you expert-validated tips and insights from the industry to help optimize mining operations. Metso is an Industry leader in end-to-end sustainable mining solutions enabling customers and clients to improve their water and energy efficiency.
metso.com
Facebook Followers 47.1KTwitter Followers 14.1K Frequency 1 post / week Domain Authority 56 Get Email Contact

60. Ilkar Blogilkar

Ilkar Blogilkar All about Finnish pop, Eurovision song contest and Sanremo festival, il festival della canzone italiana di Sanremo. And more.
ilkar.blogspot.com
Facebook Followers 41.4KTwitter Followers 766Instagram Followers 486.4K Frequency 5 posts / week Domain Authority 29 Get Email Contact

61. SAM-ERIK PRIVE'

SAM-ERIK PRIVE' This is my close and personal way of doing podcast stories from my daily life in Helsinki and from my travels.
podcasters.spotify.com
Facebook Followers 453Twitter Followers 646Instagram Followers 283LinkedInYouTube Podcast Frequency 1 post / month Domain Authority 94 Get Contact

62. DevOps Sauna from Eficode

DevOps Sauna from Eficode The future is fun, creative & automated! Eficode is a leading European DevOps, Cloud and design company
eficode.com
Facebook Followers 2.8KTwitter Followers 1.7KInstagram Followers 1.3K Frequency 1 post / week Domain Authority 42 Get Email Contact

63. Ferment Radio

Ferment Radio Welcome to Ferment Radio, a podcast series on micro and macro transformations. Fermentation can incite social action, spark creativity, and bring surprising new tastes to our lives. My name is Aga Pokrywka and I invite you to join us in a conversation on living interconnectivities: from macro to micro, from societal to cellular, and from global to personal.
podcasts.apple.com
Facebook Followers 155Twitter Followers 87Instagram Followers 2.2K Frequency 1 post / month Domain Authority 99 Get Email Contact

64. Mobile Games Playbook

Mobile Games Playbook Welcome to the ultimate podcast for mobile games - Join our host Jon Jordan and expert guests as they uncover the winning strategies and closely-guarded secrets behind game development, monetization and user acquisition.Brought to you by Liftoff, the leading growth acceleration platform, this podcast offers expert analysis and insights to elevate your mobile games!
feeds.buzzsprout.com
Facebook Followers 1.5KTwitter Followers 2.4K Frequency 1 post / month Domain Authority 84 Get Email Contact

65. SSH Blog » Privileged Access Management

SSH Blog » Privileged Access Management The SSH Blog is a go-to resource for all things related to Privileged Access Management. With a focus on secure remote access and identity management, this blog offers insights, tutorials, and best practices for effective PAM implementation. Stay connected with the SSH Blog and enhance your knowledge of managing privileged access.
ssh.com
Facebook Followers 776Twitter Followers 3.4K Frequency 2 posts / year Domain Authority 62 Get Email Contact

66. Tuonela Magazine

Tuonela Magazine Tuonela Magazine is a webzine that covers various music genres, including metal, rock, and folk music. The magazine features news, reviews, and interviews with Finnish and international musicians, as well as updates about music events and festivals in Finland.
tuonelamagazine.com
Facebook Followers 5.1KTwitter Followers 719Instagram Followers 2K Frequency 3 posts / day Domain Authority 31 Get Email Contact

67. Global South Development Magazine

Global South Development Magazine Global South Development Magazine is an online magazine on international development issues. Global South Development Magazine seeks to redefine the way international development is reported today. It reports some of the most neglected stories in global development and focuses on giving voice to the voiceless.
gsdmagazine.org
Frequency 3 posts / month Domain Authority 31 Get Email Contact

68. GameRefinery

GameRefinery All you need to know about Mobile Games! Find the latest insights on the mobile game design, market research, features, player motivations, and gaming industry in GameRefinery Blog. GameRefinery is a provider of feature-level data in the mobile games market, with an ever-growing database covering hundreds of thousands of games.
gamerefinery.com
Facebook Followers 1.5KTwitter Followers 2.4K Frequency 1 post / day Domain Authority 42 Get Email Contact

69. QPR Software Plc Blog

QPR Software Plc Blog Stay informed about process mining, performance management, and quality improvement through the QPR Software Plc Blog. This blog offers a holistic perspective on process analysis and optimization, covering topics such as process intelligence, process modeling, and data-driven decision-making. Explore their articles and resources to enhance your understanding of process management and drive organizational success.
qpr.com/blog
Facebook Followers 725Twitter Followers 956 Frequency 1 post / month Domain Authority 43 Get Email Contact

70. naaG | Men's Fashion and Lifestyle Blog.

naaG | Men's Fashion and Lifestyle Blog. This blog focuses on Men's Fashion and Lifestyle and keeps you updated with the latest trends in fashion and beauty.
naag.fi/fi
Facebook Followers 8KTwitter Followers 6.5KInstagram Followers 97.9K Frequency 11 posts / quarter Domain Authority 26 Get Email Contact

71. Globe Art Point | Finland Art Blog

Globe Art Point | Finland Art Blog They are an independent center situated in Helsinki center (Kamppi) aimed to promote equality and integration inside the Finnish art and culture sector. They distribute information especially useful for professional international artists and culture workers residing Finland, about projects, funding, labor legislation and tax system, by their website , by organising and holding events such as seminars, workshops, discussions and lectures.
globeartpoint.fi
Facebook Followers 1.8KInstagram Followers 1.8K Frequency 1 post / week Domain Authority 19 Get Email Contact

72. Jukka Niiranen Blog

Jukka Niiranen Blog Hi, I'm Jukka. I'm a 40-something business geek from Helsinki, Finland. I'm the Co-founder and Power Platform Advisor at Forward Forever. When I'm not diving deep into the latest Microsoft technologies, you may find me enjoying electronic music and live gigs, sipping on some tasty new craft beers, or traveling to places near and far.
jukkaniiranen.com
Twitter Followers 6K Frequency 1 post / quarter Domain Authority 25 Get Email Contact

73. Jazz Finland

Jazz Finland Jazz Finland is an organization that promotes jazz music in Finland. The organization supports Finnish jazz musicians and provides information about jazz events and festivals in Finland. The blog features news, interviews, and updates about the Finnish jazz scene.
jazzfinland.fi
Facebook Followers 3.1K Frequency 4 posts / week Domain Authority 37 Get Email Contact

74. Tuonela Magazine » Symphonic Metal

Tuonela Magazine » Symphonic Metal In their Symphonic Metal section, they talk about new releases, album reviews, tours, concerts, the latest news, and updates. Tuonela Magazine was founded in February 2017, with the idea of promoting both young and established Finnish bands, as well as internationally renowned and promising artists who are involved with the scene worldwide. They mostly focus on metal, rock, independent, and alternative music, but don't necessarily limit themselves to one genre.
tuonelamagazine.com
Facebook Followers 5KTwitter Followers 719Instagram Followers 2K Frequency 1 post / day Domain Authority 31 Get Email Contact

75. Sievo Blog

Sievo Blog The #1 resource for data-driven procurement leaders. Fresh tips, tricks, and insights to master analytics in procurement.
sievo.com/blog
Facebook Followers 509Twitter Followers 1.3KInstagram Followers 601 Frequency 1 post / quarter Domain Authority 31 Get Email Contact

Show 76 to 231

Helsinki Bloggers

Top Authors, Journalists, and Publishers covering Helsinki. Get Spreadsheet
Blogger NameEmailBlog LinkTotal Blog Posts
Angry Birdsyoutube.com125
Anupama paliwalmygingergarlickitchen.com40
Salibandyfiyoutube.com33
@RantanenSusannamodernemployerbrand.com24
Laurent Notinlaurentnotin.com24
Jussi Roinejussiroine.com23
Lukasz Korbarelexsolutions.com23
EuroStoriehelsinki.fi16
Anupamamygingergarlickitchen.com14
Vishnu Kdeconstructoroffun.com13
Michail Katkoffdeconstructoroffun.com12
mianguyenrelexsolutions.com10
AppFollowyoutube.com10
Riina Laineriinalaineartist.com9
Chris Hutchinsonclaned.com7
Camile Aassilanosto.com7
SalesforceWayyoutube.com7
Tatiana Pwomenintech.fi6
oonarossidigitalworkforce.com6
Liisa Mathlinblog.arilyn.com6
Juuliavaimomatskuu.com6
Prakriti Shahvaloya.com5
Kathleenmanagementevents.com5
Letitia Limmanagementevents.com5
Aamera Kothawalavisilean.com5
Juuso Lehtimäkidigitalworkforce.com5
Pål Krogdahl & Ville Sointufintechdaydreaming.com5
Pål Krogdahl and Ville Sointufintechdaydreaming.com5
matildaheiskanenrelexsolutions.com5
Alanya Hammondnosto.com4
Eve Rousenosto.com4
Joe McVeighandreadallover.com4
Nykytaiteen museo Kiasmayoutube.com4
Kate Halewooddeconstructoroffun.com4
Jean Carlos Delgadoblog.hyperin.com3
Javier Barnesdeconstructoroffun.com3
Miradoremiradore.com3
Joakim Achrenelitegamedevelopers.com2
Sanna Kaistinenarbitration.fi2
Richard Dawsrelexsolutions.com2
Oscar Santolallatimetoshinepodcast.com2
Katerina Zitkovablogs.helsinki.fi2
Jennifer Sandströmjennifersandstrom.se2
Jesper Gustavssondeconstructoroffun.com2
Mike Zaknosto.com2
Xi Xiaosalesforceway.com2
Jani K. Savolainensqlgovernor.com2
ErikKaumyoutube.com1
Paramjitvisilean.com1
Load 51 to 100 of 231 Bloggers